PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010922870.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 341aa    MW: 38781.8 Da    PI: 8.5762
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010922870.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.41.4e-5381351128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrFhPtdeel+ +yLk+++++ ++++ ++i+evdiyk++PwdLp+k+  ++kewyfFs+rd+ky++g r+nra++sgyWkatg+dk+++s+
  XP_010922870.1   8 LPPGFRFHPTDEELILHYLKNRAASFPCPV-SIIAEVDIYKFNPWDLPAKAMFGDKEWYFFSPRDRKYPNGIRPNRAAASGYWKATGTDKPIISS 101
                     79****************************.89***************888889**************************************998 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +++++g+kk Lvfy+gr pkg+ktdW+mheyrl
  XP_010922870.1 102 kGNQNIGVKKALVFYQGRPPKGVKTDWIMHEYRL 135
                     57778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019419.81E-674167IPR003441NAC domain
PROSITE profilePS5100562.1958167IPR003441NAC domain
PfamPF023655.2E-279135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MSNPATSLPP GFRFHPTDEE LILHYLKNRA ASFPCPVSII AEVDIYKFNP WDLPAKAMFG  60
DKEWYFFSPR DRKYPNGIRP NRAAASGYWK ATGTDKPIIS SKGNQNIGVK KALVFYQGRP  120
PKGVKTDWIM HEYRLADAHN NNIYRPMKLR DTSMRLDDWV LCRIYKKSNH TLSMDRQQED  180
ISVEDVFMPS LTNTTPQNNP PHLPKSCSLT DLLENVDFSA LSQLLENTAD IPSFQQDQVV  240
HPSSDQPFIN NSSSSNRSNI FIPQLSQTES PVLPAENGLK RERAIDSCLE DGGKLSRPSK  300
RLLNSSIFTN FAGQFDSPQY NLLGHPFFNQ QLLLNSNFNL R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A6e-73716916167NO APICAL MERISTEM PROTEIN
1ut4_B6e-73716916167NO APICAL MERISTEM PROTEIN
1ut7_A6e-73716916167NO APICAL MERISTEM PROTEIN
1ut7_B6e-73716916167NO APICAL MERISTEM PROTEIN
4dul_A6e-73716916167NAC domain-containing protein 19
4dul_B6e-73716916167NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010922870.10.0PREDICTED: NAC transcription factor 29-like
SwissprotA0SPJ91e-87NAM2_HORVD; NAC transcription factor NAM-2
SwissprotO492552e-88NAC29_ARATH; NAC transcription factor 29
TrEMBLM0SKF51e-152M0SKF5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr4P02380_0011e-151(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP38033775
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04070.11e-92NAC domain containing protein 47